PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010931442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 341aa    MW: 38839.8 Da    PI: 8.289
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010931442.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.37.1e-5481351128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL+++v++ ++++ ++i+evdiyk++PwdLp k+  +++ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++s+
  XP_010931442.1   8 LPPGFRFHPTDEELIQHYLRNRVASLPCPV-SIIAEVDIYKFDPWDLPVKAMFGDREWYFFSPRDRKYPNGIRPNRAAASGYWKATGTDKPIVSS 101
                     79****************************.89***************8777899**************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++e++g+kk Lvfykgr pkg+kt W+mheyrl
  XP_010931442.1 102 kGNENIGVKKALVFYKGRPPKGVKTGWIMHEYRL 135
                     67788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-655167IPR003441NAC domain
PROSITE profilePS5100561.9978167IPR003441NAC domain
PfamPF023654.6E-289135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MSNPTTSLPP GFRFHPTDEE LIQHYLRNRV ASLPCPVSII AEVDIYKFDP WDLPVKAMFG  60
DREWYFFSPR DRKYPNGIRP NRAAASGYWK ATGTDKPIVS SKGNENIGVK KALVFYKGRP  120
PKGVKTGWIM HEYRLAQALN NNSFRPMKLR DSSMRLDDWV LCRIYKKNNY TLSTDPEQDD  180
SAVEDVFMPS LTNTTPQNSP PKLPKSCSLT ELLNNVDFSA LSQLLEIPPD MPNLEQGPIV  240
HPSSNQTSIN NTSSSDANYF LVQQLSQTET PVLPPENSLK RQWTVDRCLE DGSELSHPPK  300
KLLNSSIFTS FTNQFNSQQN NLLSNPFFNQ QLQLNSYLKF Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-72716914170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931442.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-87NAC29_ARATH; NAC transcription factor 29
TrEMBLM0SKF51e-155M0SKF5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P02380_0011e-154(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38033775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.13e-95NAC domain containing protein 47